PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S09001.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family ZF-HD
Protein Properties Length: 300aa    MW: 33200.3 Da    PI: 8.3297
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S09001.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.23.4e-3274131260
    ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                    + vrY+eClkNhAa++Gg+a+DGCgEfmps geeg+++al+C+AC+CHRnFHR+eve e
  Jcr4S09001.10  74 KMVRYRECLKNHAAAMGGNATDGCGEFMPS-GEEGSIEALTCSACNCHRNFHRKEVEGE 131
                    679**************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047705.3E-2976128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2676131IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.7E-3177128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.61278127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.9E-31212281IPR009057Homeodomain-like
SuperFamilySSF466891.16E-19216280IPR009057Homeodomain-like
TIGRFAMsTIGR015651.5E-27219275IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MELSSHEGEI PIPINSSYGG GHMIHHDHHH PSTAHNHIIS SSTPQLPSNN NHNGPNSSIP  60
TPTLEVDHHV PFKKMVRYRE CLKNHAAAMG GNATDGCGEF MPSGEEGSIE ALTCSACNCH  120
RNFHRKEVEG ESSSCEYYHG NPAHFNRVAR KVILGHHKNI LAPEALGYPT NAGTFVPSRA  180
AGPPHQMIMS YNMGSIPSES DEQEDGGGVI MGRAPQIVKK RFRTKFTQEQ KEKMHNFAEK  240
VGWKIQKQEE AVVQQFCQEI GVKRRVLKVW MHNNKHNLAK KSSTTTPTIN ITTAPTPTTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-232202771875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069129.11e-165PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotQ9M9S06e-80ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A067L8R91e-164A0A067L8R9_JATCU; Uncharacterized protein
STRINGPOPTR_0004s23860.11e-151(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-76homeobox protein 31